English to Xhosa Meaning of hyphen - ikhonco


Hyphen :
ikhonco

ikhonco

iqhagamshelahyphenatehyphenatesikhonkcohyphenationshyphenedhypheningamaqhagamshela
Facebook Twitter Linkedin Share More
Definitions of hyphen in English
Noun(1) a punctuation mark (-
Verb(1) divide or connect with a hyphen
Examples of hyphen in English
(1) They've registered the name with a hyphen between the words but I own the domain as one word which is their preference.(2) The only quibble I have with the grammar of that prose is the use of a hyphen followed by a semi-colon in the final sentence.(3) Outside the University in Mumbai is the greeting ÔÇÿwel-comeÔÇÖ, with the two elements separated by a hyphen .(4) According to Jacoby, the hyphen in service-learning is symbolically representative of this symbiotic relationship.(5) He was coal and wool joined by a stately hyphen and ennobled by five coronets.(6) Imagine, Kierkegaard says, that you saw nothing but a word followed by a hyphen .(7) Two or more one-syllable words may be joined together, however, usually connected by a hyphen , to form a compound word.(8) Should your domain be one single word or should the words be separated by hyphens ?(9) As the hyphens and slash marks indicate, these emergent literatures do not fit under a single rubric.(10) Google ignores most punctuation, except apostrophes, hyphens and quote marks.(11) Yes, Ashling is one of those people who eschew normal grammar rules and use only hyphens to get their message across.(12) For those who care: in one of last week's postings, I had linked loads and loads of words together with hyphens instead of spaces.(13) For example, if you like the looks of hyphens separating datestamp, locators and descriptors, then do it that way every time.(14) Search engines see hyphens and commas as spaces, which is why they would count that example as the same word next to itself.(15) Periods and hyphens indicate, respectively, base identities and deletions.(16) Counting only letters, and ignoring characters like spaces and commas and hyphens , you can see the proof in the definition.
Related Phrases of hyphen
(1) hyphen ::
ikhonco
Synonyms
Noun
1. dash ::
dash
Verb
2. hyphenate ::
hyphenate
Different Forms
hyphen, hyphenate, hyphenates, hyphenation, hyphenations, hyphened, hyphening, hyphens
English to Xhosa Dictionary: hyphen

Meaning and definitions of hyphen, translation in Xhosa language for hyphen with similar and opposite words. Also find spoken pronunciation of hyphen in Xhosa and in English language.

Tags for the entry 'hyphen'

What hyphen means in Xhosa, hyphen meaning in Xhosa, hyphen definition, examples and pronunciation of hyphen in Xhosa language.

Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History